PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08693.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 472aa    MW: 53527.2 Da    PI: 6.2542
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08693.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.9e-142872348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT+eEd++l + +  +G+++W+ Ia+++   +t  qc+ rw++yl
       KHN08693.1 28 TWTQEEDDILREQIGVHGTENWAIIASKFK-DKTTRQCRRRWYTYL 72
                     6****************************9.*************97 PP

2Myb_DNA-binding43.76.5e-1478121146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
       KHN08693.1  78 KGGWSPEEDMLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 121
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.3282176IPR017930Myb domain
SuperFamilySSF466891.05E-2525119IPR009057Homeodomain-like
SMARTSM007177.2E-132574IPR001005SANT/Myb domain
CDDcd001673.24E-122872No hitNo description
Gene3DG3DSA:1.10.10.601.8E-202979IPR009057Homeodomain-like
PfamPF139211.4E-152989No hitNo description
SMARTSM007171.1E-1477125IPR001005SANT/Myb domain
PROSITE profilePS5129416.97577127IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-1980126IPR009057Homeodomain-like
CDDcd001672.02E-1081122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MKKQQQQEKH KKQMVNEESK KKERHIVTWT QEEDDILREQ IGVHGTENWA IIASKFKDKT  60
TRQCRRRWYT YLNSDFKKGG WSPEEDMLLC EAQKIFGNRW TEIAKVVSGR TDNAVKNRFS  120
TLCKKRAKYE ALVKENSTSY INSNNKRIFL QHGCDTDVAS ETAIKKMRRS HIPDAAEKIN  180
FGDRSHKQNG IPLNEQSRAP FAVLAQNTHN VNLPDQHHVC NLKFSDYAEN NKIQGTFLKK  240
DDPKINALMQ QAELLSSLAL KVDAENMDQS LENAWKVLQE FLNRTKESDI PRYKIPDLQL  300
VDLKELLADL KSSSEEIQPC WRQMELYEDS PGSSEYSTGS TLLPHSAGED LEHSLHQDIG  360
TELNIQIEDS EGVRGCDQGV LSSATLDQDL FPSCEEQINN DAIVSALSSS AEFSSPLQVT  420
PLFRSLAAGI PSPQFSESER SFLMKTLGME SPSLNPSVNP SQPPLCKRAL LI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-272912710108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150439e-69AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014619802.10.0PREDICTED: pre-mRNA-splicing factor CEF1-like
RefseqXP_003519765.10.0PREDICTED: pre-mRNA-splicing factor CEF1-like
RefseqXP_006574551.10.0PREDICTED: pre-mRNA-splicing factor CEF1-like
RefseqXP_006574549.10.0PREDICTED: pre-mRNA-splicing factor CEF1-like
TrEMBLA0A0B2PM390.0A0A0B2PM39_GLYSO; Myb-related protein B
TrEMBLI1JBN10.0I1JBN1_SOYBN; Uncharacterized protein
STRINGGLYMA02G02310.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-177myb domain protein 88
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]